Lineage for d2pwzg2 (2pwz G:146-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999257Species Escherichia coli K-12 [TaxId:83333] [225274] (2 PDB entries)
  8. 2999265Domain d2pwzg2: 2pwz G:146-312 [139773]
    Other proteins in same PDB: d2pwza1, d2pwzc1, d2pwze1, d2pwzg1
    automated match to d2cmda2

Details for d2pwzg2

PDB Entry: 2pwz (more details), 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase
PDB Compounds: (G:) malate dehydrogenase

SCOPe Domain Sequences for d2pwzg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwzg2 d.162.1.1 (G:146-312) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

SCOPe Domain Coordinates for d2pwzg2:

Click to download the PDB-style file with coordinates for d2pwzg2.
(The format of our PDB-style files is described here.)

Timeline for d2pwzg2: