| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries) |
| Domain d2pwze1: 2pwz E:1-145 [139770] Other proteins in same PDB: d2pwza2, d2pwzc2, d2pwze2, d2pwzg2 automated match to d2cmda1 |
PDB Entry: 2pwz (more details), 2.2 Å
SCOPe Domain Sequences for d2pwze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pwze1 c.2.1.0 (E:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg
Timeline for d2pwze1: