SCOPe 2.08: Domain d2pwza2: 2pwz A:146-312

Lineage for d2pwza2 (2pwz A:146-312)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225274] (2 PDB entries)

8. Domain d2pwza2: 2pwz A:146-312 [139767]
   Other proteins in same PDB: d2pwza1, d2pwzc1, d2pwze1, d2pwzg1
   automated match to d2cmda2

Details for d2pwza2

PDB Entry: 2pwz, 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2pwza2:

Sequence; same for both SEQRES and ATOM records:

>d2pwza2 d.162.1.1 (A:146-312) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

Timeline for d2pwza2:

• d2pwza2 first appeared in SCOP 1.73
  
• d2pwza2 appears in SCOPe 2.07