Lineage for d2pwna1 (2pwn A:12-173)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052697Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 1052698Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (3 families) (S)
  5. 1052732Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 1052733Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species)
    covalently linked long fatty acid occupies the ligand-binding cavity
  7. 1052734Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries)
    Uniprot O55013 9-173
  8. 1052736Domain d2pwna1: 2pwn A:12-173 [139764]
    automatically matched to d1wc8a_
    complexed with myr

Details for d2pwna1

PDB Entry: 2pwn (more details), 2.04 Å

PDB Description: crystal structure of bet3 homolog (13277653) from mus musculus at 2.04 a resolution
PDB Compounds: (A:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d2pwna1:

Sequence, based on SEQRES records: (download)

>d2pwna1 d.278.1.2 (A:12-173) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll
cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried

Sequence, based on observed residues (ATOM records): (download)

>d2pwna1 d.278.1.2 (A:12-173) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvnhsaliysnllcgvl
rgalemvqmaveakfvqdtlkgdgvteirmrfirried

SCOPe Domain Coordinates for d2pwna1:

Click to download the PDB-style file with coordinates for d2pwna1.
(The format of our PDB-style files is described here.)

Timeline for d2pwna1: