Lineage for d2pvwa3 (2pvw A:57-117,A:351-593)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2127054Family c.56.5.5: FolH catalytic domain-like [53210] (2 protein domains)
  6. 2127055Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
    Folate hydrolase 1, FolH homologue
  7. 2127056Species Human (Homo sapiens) [TaxId:9606] [142523] (24 PDB entries)
    Uniprot Q04609 57-117,351-593
  8. 2127061Domain d2pvwa3: 2pvw A:57-117,A:351-593 [139757]
    Other proteins in same PDB: d2pvwa1, d2pvwa2
    automatically matched to 2C6C A:57-117,A:351-593
    complexed with ca, cl, g88, nag, zn

Details for d2pvwa3

PDB Entry: 2pvw (more details), 1.71 Å

PDB Description: A high resolution structure of human glutamate carboxypeptidase II (GCPII) in complex with 2-(phosphonomethyl)pentanedioic acid (2-PMPA)
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2pvwa3:

Sequence, based on SEQRES records: (download)

>d2pvwa3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke
gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp
lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl
giasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfela
nsivl

Sequence, based on observed residues (ATOM records): (download)

>d2pvwa3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke
gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp
lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl
giasgrarytknnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansi
vl

SCOPe Domain Coordinates for d2pvwa3:

Click to download the PDB-style file with coordinates for d2pvwa3.
(The format of our PDB-style files is described here.)

Timeline for d2pvwa3: