| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.4: PA domain [52025] (1 family) ![]() |
| Family c.8.4.1: PA domain [52026] (2 proteins) |
| Protein Glutamate carboxypeptidase II [141984] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries) Uniprot Q04609 118-350 |
| Domain d2pvwa2: 2pvw A:118-350 [139756] Other proteins in same PDB: d2pvwa1, d2pvwa3 automatically matched to 2C6C A:118-350 complexed with ca, cl, g88, nag, zn |
PDB Entry: 2pvw (more details), 1.71 Å
SCOPe Domain Sequences for d2pvwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvwa2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn
Timeline for d2pvwa2: