Lineage for d2pvwa1 (2pvw A:594-750)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1736945Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1736970Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 1736971Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 1736972Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 1736973Species Human (Homo sapiens) [TaxId:9606] [140575] (23 PDB entries)
    Uniprot Q04609 594-750
  8. 1736978Domain d2pvwa1: 2pvw A:594-750 [139755]
    Other proteins in same PDB: d2pvwa2, d2pvwa3
    automatically matched to 2C6C A:594-750
    complexed with ca, cl, g88, nag, zn

Details for d2pvwa1

PDB Entry: 2pvw (more details), 1.71 Å

PDB Description: a high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with 2-(phosphonomethyl)pentanedioic acid (2-pmpa)
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2pvwa1:

Sequence, based on SEQRES records: (download)

>d2pvwa1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d2pvwa1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d2pvwa1:

Click to download the PDB-style file with coordinates for d2pvwa1.
(The format of our PDB-style files is described here.)

Timeline for d2pvwa1: