SCOPe 2.01: Domain d2pr4h2: 2pr4 H:133-232

Lineage for d2pr4h2 (2pr4 H:133-232)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2pr4h2: 2pr4 H:133-232 [139749]
   Other proteins in same PDB: d2pr4h1
   automatically matched to d2f5ah2

Details for d2pr4h2

PDB Entry: 2pr4, 2.05 Å

PDB Description: Crystal Structure of Fab' from the HIV-1 Neutralizing Antibody 2F5

PDB Compounds: (H:) nmAb 2F5 Fab' light Chain

SCOPe Domain Sequences for d2pr4h2:

Sequence, based on SEQRES records:

>d2pr4h2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records):

>d2pr4h2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Timeline for d2pr4h2:

• d2pr4h2 first appeared in SCOP 1.73
  
• d2pr4h2 appears in SCOP 1.75
  
• d2pr4h2 appears in SCOPe 2.02
  
• d2pr4h2 appears in the current release, SCOPe 2.08