Lineage for d2pqud_ (2pqu D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190768Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2190769Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2190770Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2190818Protein Poly(RC)-binding protein 2 [143220] (1 species)
    contains three KH domains
  7. 2190819Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries)
    Uniprot Q15366 11-81
  8. 2190828Domain d2pqud_: 2pqu D: [139747]
    Other proteins in same PDB: d2pqua3
    automated match to d2axya1
    protein/DNA complex; protein/RNA complex

Details for d2pqud_

PDB Entry: 2pqu (more details), 2.12 Å

PDB Description: crystal structure of kh1 domain of human pcbp2 complexed to single- stranded 12-mer telomeric dna
PDB Compounds: (D:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2pqud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqud_ d.51.1.1 (D:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
famiidklee

SCOPe Domain Coordinates for d2pqud_:

Click to download the PDB-style file with coordinates for d2pqud_.
(The format of our PDB-style files is described here.)

Timeline for d2pqud_: