Lineage for d2pqua1 (2pqu A:11-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860093Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 860094Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860095Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 860147Protein Poly(RC)-binding protein 2 [143220] (1 species)
    contains three KH domains
  7. 860148Species Human (Homo sapiens) [TaxId:9606] [143221] (3 PDB entries)
    Uniprot Q15366 11-81
  8. 860153Domain d2pqua1: 2pqu A:11-81 [139744]
    automatically matched to 2AXY A:11-81

Details for d2pqua1

PDB Entry: 2pqu (more details), 2.12 Å

PDB Description: crystal structure of kh1 domain of human pcbp2 complexed to single- stranded 12-mer telomeric dna
PDB Compounds: (A:) Poly(rC)-binding protein 2

SCOP Domain Sequences for d2pqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqua1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
nvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifk
afamiidklee

SCOP Domain Coordinates for d2pqua1:

Click to download the PDB-style file with coordinates for d2pqua1.
(The format of our PDB-style files is described here.)

Timeline for d2pqua1: