SCOPe 2.08: Domain d2pqua2: 2pqu A:11-81

Lineage for d2pqua2 (2pqu A:11-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
   an RNA-binding domain

6. Protein Poly(RC)-binding protein 2 [143220] (1 species)
   contains three KH domains

7. Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries)
   Uniprot Q15366 11-81

8. Domain d2pqua2: 2pqu A:11-81 [139744]
   Other proteins in same PDB: d2pqua3
   automated match to d2axya1
   protein/DNA complex; protein/RNA complex

Details for d2pqua2

PDB Entry: 2pqu, 2.12 Å

PDB Description: crystal structure of kh1 domain of human pcbp2 complexed to single- stranded 12-mer telomeric dna

PDB Compounds: (A:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2pqua2:

Sequence; same for both SEQRES and ATOM records:

>d2pqua2 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
nvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifk
afamiidklee

Timeline for d2pqua2:

• d2pqua2 first appeared in SCOP 1.73, called d2pqua1
  
• d2pqua2 appears in SCOPe 2.07