SCOPe 2.08: Domain d2pq2a_: 2pq2 A:

Lineage for d2pq2a_ (2pq2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Engyodontium album [TaxId:37998] [187057] (27 PDB entries)

8. Domain d2pq2a_: 2pq2 A: [139743]
   automated match to d1ic6a_
   complexed with ca, no3

Details for d2pq2a_

PDB Entry: 2pq2, 1.82 Å

PDB Description: structure of serine proteinase k complex with a highly flexible hydrophobic peptide at 1.8a resolution

PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d2pq2a_:

Sequence; same for both SEQRES and ATOM records:

>d2pq2a_ c.41.1.1 (A:) automated matches {Engyodontium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

Timeline for d2pq2a_:

• d2pq2a_ first appeared in SCOP 1.73, called d2pq2a1
  
• d2pq2a_ appears in SCOPe 2.07