Class a: All alpha proteins [46456] (284 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Type I fatty acid synthase ACP domain [89040] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89041] (1 PDB entry) |
Domain d2pnga1: 2png A:1-76 [139742] automatically matched to d1n8la_ |
PDB Entry: 2png (more details)
SCOPe Domain Sequences for d2pnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire vrqltlrklqemsska
Timeline for d2pnga1: