![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries) |
![]() | Domain d2pmja1: 2pmj A:1-133 [139741] automatically matched to d1cl5a_ complexed with ccn, cou |
PDB Entry: 2pmj (more details), 2.4 Å
SCOP Domain Sequences for d2pmja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmja1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d2pmja1: