Lineage for d2plpa1 (2plp A:7-60)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934705Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)
  8. 2934769Domain d2plpa1: 2plp A:7-60 [139740]
    automatically matched to d1gb1__

Details for d2plpa1

PDB Entry: 2plp (more details)

PDB Description: ultra high resolution backbone conformation of protein gb1 from residual dipolar couplings alone
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2plpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plpa1 d.15.7.1 (A:7-60) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
tyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt

SCOPe Domain Coordinates for d2plpa1:

Click to download the PDB-style file with coordinates for d2plpa1.
(The format of our PDB-style files is described here.)

Timeline for d2plpa1: