SCOPe 2.06: Domain d2pkrm2: 2pkr M:149-312

Lineage for d2pkrm2 (2pkr M:149-312)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
   Uniprot P19866

8. Domain d2pkrm2: 2pkr M:149-312 [139731]
   Other proteins in same PDB: d2pkra1, d2pkrb1, d2pkrc1, d2pkrd1, d2pkrh1, d2pkri1, d2pkrl1, d2pkrm1, d2pkro1, d2pkrp1, d2pkrq1, d2pkrr1
   automatically matched to d1nboa2
   complexed with ndp, so4

Details for d2pkrm2

PDB Entry: 2pkr, 2.4 Å

PDB Description: crystal structure of (a+cte)4 chimeric form of photosyntetic glyceraldehyde-3-phosphate dehydrogenase, complexed with nadp

PDB Compounds: (M:) Glyceraldehyde-3-phosphate dehydrogenase Aor

SCOPe Domain Sequences for d2pkrm2:

Sequence; same for both SEQRES and ATOM records:

>d2pkrm2 d.81.1.1 (M:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

Timeline for d2pkrm2:

• d2pkrm2 first appeared in SCOP 1.73
  
• d2pkrm2 appears in SCOPe 2.05
  
• d2pkrm2 appears in SCOPe 2.07
  
• d2pkrm2 appears in the current release, SCOPe 2.08