Lineage for d2pkra1 (2pkr A:0-148,A:313-333)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1152379Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1152583Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1152714Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
    Uniprot P19866
  8. 1152727Domain d2pkra1: 2pkr A:0-148,A:313-333 [139716]
    Other proteins in same PDB: d2pkra2, d2pkrb2, d2pkrc2, d2pkrd2, d2pkrh2, d2pkri2, d2pkrl2, d2pkrm2, d2pkro2, d2pkrp2, d2pkrq2, d2pkrr2
    automatically matched to d1nboa1
    complexed with ndp, so4

Details for d2pkra1

PDB Entry: 2pkr (more details), 2.4 Å

PDB Description: crystal structure of (a+cte)4 chimeric form of photosyntetic glyceraldehyde-3-phosphate dehydrogenase, complexed with nadp
PDB Compounds: (A:) Glyceraldehyde-3-phosphate dehydrogenase Aor

SCOPe Domain Sequences for d2pkra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkra1 c.2.1.3 (A:0-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOPe Domain Coordinates for d2pkra1:

Click to download the PDB-style file with coordinates for d2pkra1.
(The format of our PDB-style files is described here.)

Timeline for d2pkra1: