Lineage for d2pkqp2 (2pkq P:149-312)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210563Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1210564Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1210565Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1210619Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1210750Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 1210780Domain d2pkqp2: 2pkq P:149-312 [139711]
    Other proteins in same PDB: d2pkqo1, d2pkqp1, d2pkqq1, d2pkqr1, d2pkqs1, d2pkqt1
    automatically matched to d1nboa2
    complexed with ndp, so4

Details for d2pkqp2

PDB Entry: 2pkq (more details), 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp
PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d2pkqp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkqp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOPe Domain Coordinates for d2pkqp2:

Click to download the PDB-style file with coordinates for d2pkqp2.
(The format of our PDB-style files is described here.)

Timeline for d2pkqp2: