Lineage for d2pkgb1 (2pkg B:10-588)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006481Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2006482Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries)
  8. 2006496Domain d2pkgb1: 2pkg B:10-588 [139709]
    Other proteins in same PDB: d2pkgc1, d2pkgd1
    automatically matched to d1b3ua_
    complexed with zn

Details for d2pkgb1

PDB Entry: 2pkg (more details), 3.3 Å

PDB Description: Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40
PDB Compounds: (B:) Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

SCOPe Domain Sequences for d2pkgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkgb1 a.118.1.2 (B:10-588) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
lypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevllal
aeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahfv
plvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaaskl
gefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptlr
qaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvkef
cenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllplf
laqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieympl
lagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvlam
sgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkigp
ildnstlqsevkpilekltqdqdvdvkyfaqealtvlsl

SCOPe Domain Coordinates for d2pkgb1:

Click to download the PDB-style file with coordinates for d2pkgb1.
(The format of our PDB-style files is described here.)

Timeline for d2pkgb1: