Lineage for d2pk8a_ (2pk8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009425Fold d.274: Hypothetical protein PF0899 [111056] (1 superfamily)
    alpha-beta-alpha-beta(4); 2 layers: a/b; mixed beta-sheet, order 23145, strands 1 and 3 are parallel; similar to the GAPDH C-terminal domain-like fold (55346)
  4. 3009426Superfamily d.274.1: Hypothetical protein PF0899 [111057] (1 family) (S)
    possibly related to Major capsid protein gp5 (56563)63566
    automatically mapped to Pfam PF08967
  5. 3009427Family d.274.1.1: Hypothetical protein PF0899 [111058] (1 protein)
  6. 3009428Protein Hypothetical protein PF0899 [111059] (1 species)
  7. 3009429Species Pyrococcus furiosus [TaxId:2261] [111060] (1 PDB entry)
    Uniprot Q8U2E0
  8. 3009430Domain d2pk8a_: 2pk8 A: [139707]
    automated match to d1shea_
    complexed with auc

Details for d2pk8a_

PDB Entry: 2pk8 (more details), 1.85 Å

PDB Description: crystal structure of an uncharacterized protein pf0899 from pyrococcus furiosus
PDB Compounds: (A:) Uncharacterized protein PF0899

SCOPe Domain Sequences for d2pk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk8a_ d.274.1.1 (A:) Hypothetical protein PF0899 {Pyrococcus furiosus [TaxId: 2261]}
strgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsni
kieileelggdavvidskvlglvpgaakrikiik

SCOPe Domain Coordinates for d2pk8a_:

Click to download the PDB-style file with coordinates for d2pk8a_.
(The format of our PDB-style files is described here.)

Timeline for d2pk8a_: