![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.274: Hypothetical protein PF0899 [111056] (1 superfamily) alpha-beta-alpha-beta(4); 2 layers: a/b; mixed beta-sheet, order 23145, strands 1 and 3 are parallel; similar to the GAPDH C-terminal domain-like fold (55346) |
![]() | Superfamily d.274.1: Hypothetical protein PF0899 [111057] (1 family) ![]() possibly related to Major capsid protein gp5 (56563)63566 automatically mapped to Pfam PF08967 |
![]() | Family d.274.1.1: Hypothetical protein PF0899 [111058] (1 protein) |
![]() | Protein Hypothetical protein PF0899 [111059] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [111060] (1 PDB entry) Uniprot Q8U2E0 |
![]() | Domain d2pk8a_: 2pk8 A: [139707] automated match to d1shea_ complexed with auc |
PDB Entry: 2pk8 (more details), 1.85 Å
SCOPe Domain Sequences for d2pk8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pk8a_ d.274.1.1 (A:) Hypothetical protein PF0899 {Pyrococcus furiosus [TaxId: 2261]} strgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsni kieileelggdavvidskvlglvpgaakrikiik
Timeline for d2pk8a_: