SCOPe 2.01: Domain d2pk6b_: 2pk6 B:

Lineage for d2pk6b_ (2pk6 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2pk6b_: 2pk6 B: [139706]
   automated match to d1a30a_
   complexed with gol, o33

Details for d2pk6b_

PDB Entry: 2pk6, 1.45 Å

PDB Description: crystal structure of hiv-1 protease (q7k, l33i, l63i) in complex with kni-10033

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2pk6b_:

Sequence; same for both SEQRES and ATOM records:

>d2pk6b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2pk6b_:

• d2pk6b_ first appeared in SCOP 1.73, called d2pk6b1
  
• d2pk6b_ was called d2pk6b1 in SCOP 1.75
  
• d2pk6b_ appears in SCOPe 2.02
  
• d2pk6b_ appears in the current release, SCOPe 2.08