![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
![]() | Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) ![]() |
![]() | Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
![]() | Protein Arginase [52770] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries) Uniprot P05089 5-313 |
![]() | Domain d2phob_: 2pho B: [139699] automated match to d1hqfa_ complexed with mn, tsz |
PDB Entry: 2pho (more details), 1.95 Å
SCOPe Domain Sequences for d2phob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phob_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]} rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg laregnhkpidyl
Timeline for d2phob_: