SCOPe 2.08: Domain d2phob_: 2pho B:

Lineage for d2phob_ (2pho B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries)
   Uniprot P05089 5-313

8. Domain d2phob_: 2pho B: [139699]
   automated match to d1hqfa_
   complexed with mn, tsz

Details for d2phob_

PDB Entry: 2pho, 1.95 Å

PDB Description: Crystal structure of human arginase I complexed with thiosemicarbazide at 1.95 resolution

PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d2phob_:

Sequence; same for both SEQRES and ATOM records:

>d2phob_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

Timeline for d2phob_:

• d2phob_ first appeared in SCOP 1.73, called d2phob1
  
• d2phob_ appears in SCOPe 2.07