Lineage for d2phoa_ (2pho A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2129861Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2129882Protein Arginase [52770] (5 species)
  7. 2129914Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 2129949Domain d2phoa_: 2pho A: [139698]
    automated match to d1hqfa_
    complexed with mn, tsz

Details for d2phoa_

PDB Entry: 2pho (more details), 1.95 Å

PDB Description: Crystal structure of human arginase I complexed with thiosemicarbazide at 1.95 resolution
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d2phoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phoa_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

SCOPe Domain Coordinates for d2phoa_:

Click to download the PDB-style file with coordinates for d2phoa_.
(The format of our PDB-style files is described here.)

Timeline for d2phoa_: