SCOP 1.73: Domain d2phnb1: 2phn B:1-249

Lineage for d2phnb1 (2phn B:1-249)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.340: CofE-like [144009] (1 superfamily)
   consists of two different domains; d1: beta-alpha-beta-alpha-beta(2)-alpha-beta, mixed sheet of 5 strands, order:15234, strands 2 and 3 are parralel; d2 is inserted in d1 after strand 2 and comprises a helix-turn-helix motif and two 3-stranded sheets

4. Superfamily d.340.1: CofE-like [144010] (1 family)

5. Family d.340.1.1: CofE-like [144011] (1 protein)
   Pfam PF01996; DUF129; contains known activity

6. Protein F420-0:gamma-glutamyl ligase CofE [144012] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [144013] (2 PDB entries)

8. Domain d2phnb1: 2phn B:1-249 [139697]
   automatically matched to 2G9I A:1-249
   complexed with act, edo, gdp, gol, mn

Details for d2phnb1

PDB Entry: 2phn, 1.35 Å

PDB Description: Crystal structure of an amide bond forming F420-gamma glutamyl ligase from Archaeoglobus fulgidus

PDB Compounds: (B:) F420-0:gamma-glutamyl ligase

SCOP Domain Sequences for d2phnb1:

Sequence; same for both SEQRES and ATOM records:

>d2phnb1 d.340.1.1 (B:1-249) F420-0:gamma-glutamyl ligase CofE {Archaeoglobus fulgidus [TaxId: 2234]}
mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse
rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll
ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrk
dlygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedv
irrclkrcl

Timeline for d2phnb1:

• d2phnb1 is new in SCOP 1.73
  
• d2phnb1 appears in SCOP 1.75
  
• d2phnb1 appears in the current release, SCOPe 2.08, called d2phnb_