Lineage for d2phna1 (2phn A:2-249)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882732Fold d.340: CofE-like [144009] (1 superfamily)
    consists of two different domains; d1: beta-alpha-beta-alpha-beta(2)-alpha-beta, mixed sheet of 5 strands, order:15234, strands 2 and 3 are parralel; d2 is inserted in d1 after strand 2 and comprises a helix-turn-helix motif and two 3-stranded sheets
  4. 882733Superfamily d.340.1: CofE-like [144010] (1 family) (S)
  5. 882734Family d.340.1.1: CofE-like [144011] (1 protein)
    Pfam PF01996; DUF129; contains known activity
  6. 882735Protein F420-0:gamma-glutamyl ligase CofE [144012] (1 species)
  7. 882736Species Archaeoglobus fulgidus [TaxId:2234] [144013] (2 PDB entries)
    Uniprot O28028 1-249
  8. 882737Domain d2phna1: 2phn A:2-249 [139696]
    automatically matched to 2G9I A:1-249
    complexed with act, edo, gdp, gol, mn

Details for d2phna1

PDB Entry: 2phn (more details), 1.35 Å

PDB Description: Crystal structure of an amide bond forming F420-gamma glutamyl ligase from Archaeoglobus fulgidus
PDB Compounds: (A:) F420-0:gamma-glutamyl ligase

SCOP Domain Sequences for d2phna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phna1 d.340.1.1 (A:2-249) F420-0:gamma-glutamyl ligase CofE {Archaeoglobus fulgidus [TaxId: 2234]}
rvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpser
akeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslllp
pldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrkd
lygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedvi
rrclkrcl

SCOP Domain Coordinates for d2phna1:

Click to download the PDB-style file with coordinates for d2phna1.
(The format of our PDB-style files is described here.)

Timeline for d2phna1: