Lineage for d2phna_ (2phn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011254Fold d.340: CofE-like [144009] (1 superfamily)
    consists of two different domains; d1: beta-alpha-beta-alpha-beta(2)-alpha-beta, mixed sheet of 5 strands, order:15234, strands 2 and 3 are parralel; d2 is inserted in d1 after strand 2 and comprises a helix-turn-helix motif and two 3-stranded sheets
  4. 3011255Superfamily d.340.1: CofE-like [144010] (1 family) (S)
    automatically mapped to Pfam PF01996
  5. 3011256Family d.340.1.1: CofE-like [144011] (1 protein)
    Pfam PF01996; DUF129; contains known activity
  6. 3011257Protein F420-0:gamma-glutamyl ligase CofE [144012] (1 species)
  7. 3011258Species Archaeoglobus fulgidus [TaxId:2234] [144013] (2 PDB entries)
    Uniprot O28028 1-249
  8. 3011259Domain d2phna_: 2phn A: [139696]
    automated match to d2g9ia1
    complexed with act, edo, gdp, gol, mn

Details for d2phna_

PDB Entry: 2phn (more details), 1.35 Å

PDB Description: Crystal structure of an amide bond forming F420-gamma glutamyl ligase from Archaeoglobus fulgidus
PDB Compounds: (A:) F420-0:gamma-glutamyl ligase

SCOPe Domain Sequences for d2phna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phna_ d.340.1.1 (A:) F420-0:gamma-glutamyl ligase CofE {Archaeoglobus fulgidus [TaxId: 2234]}
rvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpser
akeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslllp
pldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrkd
lygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedvi
rrclkrcl

SCOPe Domain Coordinates for d2phna_:

Click to download the PDB-style file with coordinates for d2phna_.
(The format of our PDB-style files is described here.)

Timeline for d2phna_: