Lineage for d2phga2 (2phg A:208-316)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718661Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)
  6. 2718662Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)
  7. 2718663Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries)
  8. 2718677Domain d2phga2: 2phg A:208-316 [139695]
    Other proteins in same PDB: d2phga3
    automated match to d1vola2

Details for d2phga2

PDB Entry: 2phg (more details)

PDB Description: model for vp16 binding to tfiib
PDB Compounds: (A:) transcription initiation factor iib

SCOPe Domain Sequences for d2phga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phga2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

SCOPe Domain Coordinates for d2phga2:

Click to download the PDB-style file with coordinates for d2phga2.
(The format of our PDB-style files is described here.)

Timeline for d2phga2: