![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
![]() | Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) ![]() |
![]() | Family d.18.1.1: Transcriptional coactivator PC4 C-terminal domain [54448] (1 protein) dimer of two separate motifs automatically mapped to Pfam PF02229 |
![]() | Protein Transcriptional coactivator PC4 C-terminal domain [54449] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54450] (3 PDB entries) |
![]() | Domain d2pheb1: 2phe B:62-126 [139693] Other proteins in same PDB: d2phea2, d2pheb2 automatically matched to d1pcfa_ |
PDB Entry: 2phe (more details)
SCOPe Domain Sequences for d2pheb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pheb1 d.18.1.1 (B:62-126) Transcriptional coactivator PC4 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mfqigkmryvsvrdfkgkvlidireywmdpegemkpgrkgislnpeqwsqlkeqisdidd avrkl
Timeline for d2pheb1: