| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) ![]() |
| Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
| Protein Dynein light chain 1 (DLC1) [54650] (3 species) synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (8 PDB entries) |
| Domain d2pg1d_: 2pg1 D: [139687] automated match to d1rhwa_ complexed with so4 |
PDB Entry: 2pg1 (more details), 2.8 Å
SCOPe Domain Sequences for d2pg1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pg1d_ d.39.1.1 (D:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg
Timeline for d2pg1d_: