SCOPe 2.04: Domain d2pg1b_: 2pg1 B:

Lineage for d2pg1b_ (2pg1 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (9 PDB entries)

8. Domain d2pg1b_: 2pg1 B: [139685]
   automated match to d1rhwa_
   complexed with so4

Details for d2pg1b_

PDB Entry: 2pg1, 2.8 Å

PDB Description: Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex

PDB Compounds: (B:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d2pg1b_:

Sequence; same for both SEQRES and ATOM records:

>d2pg1b_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

Timeline for d2pg1b_:

• d2pg1b_ first appeared in SCOP 1.73, called d2pg1b1
  
• d2pg1b_ appears in SCOPe 2.03
  
• d2pg1b_ appears in SCOPe 2.05
  
• d2pg1b_ appears in the current release, SCOPe 2.08