Lineage for d2pe6b_ (2pe6 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402285Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1402291Species Human (Homo sapiens) [TaxId:9606] [54242] (9 PDB entries)
    Uniprot Q93068
  8. 1402294Domain d2pe6b_: 2pe6 B: [139668]
    Other proteins in same PDB: d2pe6a_
    automated match to d1a5r__

Details for d2pe6b_

PDB Entry: 2pe6 (more details), 2.4 Å

PDB Description: non-covalent complex between human sumo-1 and human ubc9
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2pe6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pe6b_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeq

SCOPe Domain Coordinates for d2pe6b_:

Click to download the PDB-style file with coordinates for d2pe6b_.
(The format of our PDB-style files is described here.)

Timeline for d2pe6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pe6a_