SCOPe 2.02: Domain d2pe6b_: 2pe6 B:

Lineage for d2pe6b_ (2pe6 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
   Uniprot Q93068

8. Domain d2pe6b_: 2pe6 B: [139668]
   Other proteins in same PDB: d2pe6a_
   automated match to d1a5r__

Details for d2pe6b_

PDB Entry: 2pe6, 2.4 Å

PDB Description: non-covalent complex between human sumo-1 and human ubc9

PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2pe6b_:

Sequence; same for both SEQRES and ATOM records:

>d2pe6b_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeq

Timeline for d2pe6b_:

• d2pe6b_ first appeared in SCOP 1.73, called d2pe6b1
  
• d2pe6b_ appears in SCOPe 2.01
  
• d2pe6b_ appears in SCOPe 2.03
  
• d2pe6b_ appears in the current release, SCOPe 2.08