| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries) Uniprot Q93068 |
| Domain d2pe6b_: 2pe6 B: [139668] Other proteins in same PDB: d2pe6a_ automated match to d1a5r__ |
PDB Entry: 2pe6 (more details), 2.4 Å
SCOPe Domain Sequences for d2pe6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pe6b_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeq
Timeline for d2pe6b_: