SCOP 1.75: Domain d2pe6b1: 2pe6 B:21-94

Lineage for d2pe6b1 (2pe6 B:21-94)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries)
   Uniprot Q93068

8. Domain d2pe6b1: 2pe6 B:21-94 [139668]
   Other proteins in same PDB: d2pe6a1
   automatically matched to d1tgzb_

Details for d2pe6b1

PDB Entry: 2pe6, 2.4 Å

PDB Description: non-covalent complex between human sumo-1 and human ubc9

PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOP Domain Sequences for d2pe6b1:

Sequence; same for both SEQRES and ATOM records:

>d2pe6b1 d.15.1.1 (B:21-94) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeq

Timeline for d2pe6b1:

• d2pe6b1 first appeared in SCOP 1.73
  
• d2pe6b1 is called d2pe6b_ in SCOPe 2.01
  
• d2pe6b1 appears in the current release, SCOPe 2.08, called d2pe6b_