Lineage for d2pe2a1 (2pe2 A:74-359)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734711Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 734712Species Human (Homo sapiens) [TaxId:9606] [90037] (12 PDB entries)
  8. 734717Domain d2pe2a1: 2pe2 A:74-359 [139666]
    automatically matched to d1h1wa_
    complexed with 464, gol, so4

Details for d2pe2a1

PDB Entry: 2pe2 (more details), 2.13 Å

PDB Description: crystal structure of human phosphoinositide-dependent protein kinase 1 (pdk1) 3-{5-[2-oxo-5-ureido-1,2-dihydro-indol-(3z)-ylidenemethyl]-1h-pyrrol-3-yl}-n-(2-piperidin-1-yl-ethyl)-benzamide complex
PDB Compounds: (A:) 3-phosphoinositide-dependent protein kinase 1

SCOP Domain Sequences for d2pe2a1:

Sequence, based on SEQRES records: (download)

>d2pe2a1 d.144.1.7 (A:74-359) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
eylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspel
lteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlv
ekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

Sequence, based on observed residues (ATOM records): (download)

>d2pe2a1 d.144.1.7 (A:74-359) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
eylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackss
dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
rlgceemegygplkahpffesvtwenlhqqtppklt

SCOP Domain Coordinates for d2pe2a1:

Click to download the PDB-style file with coordinates for d2pe2a1.
(The format of our PDB-style files is described here.)

Timeline for d2pe2a1: