Lineage for d2pe0a_ (2pe0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586211Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 2586212Species Human (Homo sapiens) [TaxId:9606] [90037] (25 PDB entries)
    Uniprot O15530 75-363
  8. 2586227Domain d2pe0a_: 2pe0 A: [139664]
    automated match to d1h1wa_
    complexed with 39z, gol, so4

Details for d2pe0a_

PDB Entry: 2pe0 (more details), 2.35 Å

PDB Description: crystal structure of human phosphoinositide-dependent protein kinase 1 (pdk1) 5-hydroxy-3-[1-(1h-pyrrol-2-yl)-eth-(z)-ylidene]-1,3-dihydro-indol-2-one complex
PDB Compounds: (A:) 3-phosphoinositide-dependent protein kinase 1

SCOPe Domain Sequences for d2pe0a_:

Sequence, based on SEQRES records: (download)

>d2pe0a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
eylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspel
lteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlv
ekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

Sequence, based on observed residues (ATOM records): (download)

>d2pe0a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
eylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackss
dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
rlgceemegygplkahpffesvtwenlhqqtppklt

SCOPe Domain Coordinates for d2pe0a_:

Click to download the PDB-style file with coordinates for d2pe0a_.
(The format of our PDB-style files is described here.)

Timeline for d2pe0a_: