SCOP 1.75: Domain d2pd3b1: 2pd3 B:2-275

Lineage for d2pd3b1 (2pd3 B:2-275)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (6 species)

7. Species Helicobacter pylori [TaxId:210] [102151] (2 PDB entries)

8. Domain d2pd3b1: 2pd3 B:2-275 [139657]
   automatically matched to d1jvfa_
   complexed with nad, tcl

Details for d2pd3b1

PDB Entry: 2pd3, 2.5 Å

PDB Description: Crystal Structure of the Helicobacter pylori Enoyl-Acyl Carrier Protein Reductase in Complex with Hydroxydiphenyl Ether Compounds, Triclosan and Diclosan

PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOP Domain Sequences for d2pd3b1:

Sequence; same for both SEQRES and ATOM records:

>d2pd3b1 c.2.1.2 (B:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}
gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
evhfvdagyhvmgmgaveekdnkatllwdlhkeq

Timeline for d2pd3b1:

• d2pd3b1 first appeared in SCOP 1.73
  
• d2pd3b1 is called d2pd3b_ in SCOPe 2.01
  
• d2pd3b1 appears in the current release, SCOPe 2.08, called d2pd3b_