SCOP 1.73: Domain d2pc6d1: 2pc6 D:78-163

Lineage for d2pc6d1 (2pc6 D:78-163)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.6: IlvH-like [143376] (1 protein)
   Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes

6. Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)

7. Species Nitrosomonas europaea [TaxId:915] [143380] (1 PDB entry)

8. Domain d2pc6d1: 2pc6 D:78-163 [139653]
   automatically matched to 2FGD A:78-163
   complexed with ca, sin

Details for d2pc6d1

PDB Entry: 2pc6, 2.5 Å

PDB Description: crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea

PDB Compounds: (D:) Probable acetolactate synthase isozyme III (Small subunit)

SCOP Domain Sequences for d2pc6d1:

Sequence; same for both SEQRES and ATOM records:

>d2pc6d1 d.58.18.6 (D:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]}
segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa
vdcnlileiartgvsglsrgervlkl

Timeline for d2pc6d1:

• d2pc6d1 is new in SCOP 1.73
  
• d2pc6d1 appears in SCOP 1.75
  
• d2pc6d1 appears in the current release, SCOPe 2.08