Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.6: IlvH-like [143376] (2 proteins) Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes |
Protein Acetolactate synthase small subunit, IlvH [143377] (3 species) |
Species Nitrosomonas europaea [TaxId:915] [143380] (1 PDB entry) Uniprot Q82UZ2 1-77! Uniprot Q82UZ2 78-163 |
Domain d2pc6d1: 2pc6 D:78-163 [139653] Other proteins in same PDB: d2pc6a3, d2pc6c3 automated match to d2f1fa2 complexed with ca, unl |
PDB Entry: 2pc6 (more details), 2.5 Å
SCOPe Domain Sequences for d2pc6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pc6d1 d.58.18.6 (D:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa vdcnlileiartgvsglsrgervlkl
Timeline for d2pc6d1: