Lineage for d2pc6b1 (2pc6 B:78-163)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725358Family d.58.18.6: IlvH-like [143376] (1 protein)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. 725359Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)
  7. 725365Species Nitrosomonas europaea [TaxId:915] [143380] (1 PDB entry)
  8. 725368Domain d2pc6b1: 2pc6 B:78-163 [139649]
    automatically matched to 2FGD A:78-163
    complexed with ca, sin

Details for d2pc6b1

PDB Entry: 2pc6 (more details), 2.5 Å

PDB Description: crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea
PDB Compounds: (B:) Probable acetolactate synthase isozyme III (Small subunit)

SCOP Domain Sequences for d2pc6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pc6b1 d.58.18.6 (B:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]}
segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa
vdcnlileiartgvsglsrgervlkl

SCOP Domain Coordinates for d2pc6b1:

Click to download the PDB-style file with coordinates for d2pc6b1.
(The format of our PDB-style files is described here.)

Timeline for d2pc6b1: