SCOPe 2.08: Domain d2pb1a_: 2pb1 A:

Lineage for d2pb1a_ (2pb1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Exo-beta-(1,3)-glucanase [51495] (2 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [51496] (4 PDB entries)

8. Domain d2pb1a_: 2pb1 A: [139645]
   automated match to d1cz1a_
   complexed with g2f, nfg

Details for d2pb1a_

PDB Entry: 2pb1, 1.9 Å

PDB Description: exo-b-(1,3)-glucanase from candida albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2- fluoro-b-d-glucopyranoside at 1.9 a

PDB Compounds: (A:) Hypothetical protein XOG1

SCOPe Domain Sequences for d2pb1a_:

Sequence; same for both SEQRES and ATOM records:

>d2pb1a_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

Timeline for d2pb1a_:

• d2pb1a_ first appeared in SCOP 1.73, called d2pb1a1
  
• d2pb1a_ appears in SCOPe 2.07