SCOPe 2.06: Domain d2paqa_: 2paq A:

Lineage for d2paqa_ (2paq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein 5'-nucleotidase YfbR [116969] (1 species)

7. Species Escherichia coli [TaxId:562] [116970] (3 PDB entries)
   Uniprot P76491
   Structural genomics target

8. Domain d2paqa_: 2paq A: [139643]
   automated match to d1wpha_

Details for d2paqa_

PDB Entry: 2paq, 2.1 Å

PDB Description: crystal structure of the 5'-deoxynucleotidase yfbr

PDB Compounds: (A:) 5'-deoxynucleotidase YfbR

SCOPe Domain Sequences for d2paqa_:

Sequence, based on SEQRES records:

>d2paqa_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records):

>d2paqa_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

Timeline for d2paqa_:

• d2paqa_ first appeared in SCOP 1.73, called d2paqa1
  
• d2paqa_ appears in SCOPe 2.05
  
• d2paqa_ appears in SCOPe 2.07
  
• d2paqa_ appears in the current release, SCOPe 2.08