| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
| Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
| Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
| Domain d2pa3a3: 2pa3 A:327-410 [139640] Other proteins in same PDB: d2pa3a1, d2pa3a2 automatically matched to d1psda3 complexed with nai, ser; mutant |
PDB Entry: 2pa3 (more details), 2.74 Å
SCOPe Domain Sequences for d2pa3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pa3a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly
Timeline for d2pa3a3: