![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) ![]() |
![]() | Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein) |
![]() | Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries) |
![]() | Domain d2p9ue1: 2p9u E:2-175 [139635] Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9uc1, d2p9ud1, d2p9ud2, d2p9uf1, d2p9ug1 automatically matched to d1k8ke_ complexed with anp, ca |
PDB Entry: 2p9u (more details), 2.75 Å
SCOP Domain Sequences for d2p9ue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ue1 a.148.1.1 (E:2-175) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9ue1: