| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) ![]() automatically mapped to Pfam PF04062 |
| Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
| Protein automated matches [190347] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
| Domain d2p9ue_: 2p9u E: [139635] Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9ub1, d2p9uc_, d2p9ud1, d2p9ud2, d2p9uf_, d2p9ug_ automated match to d1k8ke_ complexed with anp, ca |
PDB Entry: 2p9u (more details), 2.75 Å
SCOPe Domain Sequences for d2p9ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ue_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9ue_: