![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
![]() | Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
![]() | Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
![]() | Domain d2p9ud2: 2p9u D:121-282 [139634] Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9ub1, d2p9uc_, d2p9ue_, d2p9uf_, d2p9ug_ automated match to d1k8kd2 complexed with anp, ca |
PDB Entry: 2p9u (more details), 2.75 Å
SCOPe Domain Sequences for d2p9ud2:
Sequence, based on SEQRES records: (download)
>d2p9ud2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp
>d2p9ud2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshreppleltdaavgdnigyitfvlfprhtnasardntin lihtfrdylhyhikcskayihtrmraktsdflkvlnrarp
Timeline for d2p9ud2: