![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) ![]() automatically mapped to Pfam PF04699 |
![]() | Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins) |
![]() | Protein automated matches [190348] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries) |
![]() | Domain d2p9sg_: 2p9s G: [139629] Other proteins in same PDB: d2p9sa1, d2p9sa2, d2p9sb_, d2p9sc_, d2p9sd1, d2p9sd2, d2p9se_, d2p9sf_ automated match to d1k8kg_ complexed with atp, mg |
PDB Entry: 2p9s (more details), 2.68 Å
SCOPe Domain Sequences for d2p9sg_:
Sequence, based on SEQRES records: (download)
>d2p9sg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} frkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintksqa vkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhe kalaaggvgsivrvltarktv
>d2p9sg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} frkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdrag sivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaag gvgsivrvltarktv
Timeline for d2p9sg_: