SCOP 1.73: Domain d2p9sa1: 2p9s A:3-160

Lineage for d2p9sa1 (2p9s A:3-160)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)

8. Domain d2p9sa1: 2p9s A:3-160 [139622]
   Other proteins in same PDB: d2p9sc1, d2p9sd1, d2p9sd2, d2p9se1, d2p9sf1, d2p9sg1
   automatically matched to d1tyqa1
   complexed with atp, mg

Details for d2p9sa1

PDB Entry: 2p9s, 2.68 Å

PDB Description: Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+

PDB Compounds: (A:) actin-like protein 3

SCOP Domain Sequences for d2p9sa1:

Sequence, based on SEQRES records:

>d2p9sa1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d2p9sa1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrge

Timeline for d2p9sa1:

• d2p9sa1 is new in SCOP 1.73
  
• d2p9sa1 appears in SCOP 1.75
  
• d2p9sa1 appears in the current release, SCOPe 2.08