![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) ![]() automatically mapped to Pfam PF04062 |
![]() | Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
![]() | Protein automated matches [190347] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187174] (11 PDB entries) |
![]() | Domain d2p9pe_: 2p9p E: [139619] Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pb_, d2p9pc_, d2p9pd1, d2p9pd2, d2p9pf_, d2p9pg_ automated match to d1k8ke_ complexed with adp, ca |
PDB Entry: 2p9p (more details), 2.9 Å
SCOPe Domain Sequences for d2p9pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9pe_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9pe_: