SCOP 1.73: Domain d2p9pa1: 2p9p A:3-155

Lineage for d2p9pa1 (2p9p A:3-155)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)

8. Domain d2p9pa1: 2p9p A:3-155 [139614]
   Other proteins in same PDB: d2p9pc1, d2p9pd1, d2p9pd2, d2p9pe1, d2p9pf1, d2p9pg1
   automatically matched to d1tyqa1
   complexed with adp, ca

Details for d2p9pa1

PDB Entry: 2p9p, 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp

PDB Compounds: (A:) actin-like protein 3

SCOP Domain Sequences for d2p9pa1:

Sequence, based on SEQRES records:

>d2p9pa1 c.55.1.1 (A:3-155) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswts

Sequence, based on observed residues (ATOM records):

>d2p9pa1 c.55.1.1 (A:3-155) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat
kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf
nvpglyiavqavlalaaswts

Timeline for d2p9pa1:

• d2p9pa1 is new in SCOP 1.73
  
• d2p9pa1 appears in SCOP 1.75
  
• d2p9pa1 appears in the current release, SCOPe 2.08